PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G01950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 393aa    MW: 41840.7 Da    PI: 7.0686
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G01950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.88.7e-53111391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+
  OGLUM06G01950.1  11 VPPGFRFHPTEEELLTYYLKKKVASERIDL-DVIRDVDLNKLEPWDIQErcRIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKA 103
                      69****************************.9***************953444443456*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++s +++ +g++ktLvfykgrap+g+k+dW+mheyrl
  OGLUM06G01950.1 104 IYS-SSNRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                      ***.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-577187IPR003441NAC domain
PROSITE profilePS5100556.00211187IPR003441NAC domain
PfamPF023656.4E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MSISVNGQSV VPPGFRFHPT EEELLTYYLK KKVASERIDL DVIRDVDLNK LEPWDIQERC  60
RIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYSSSNR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DPSSASASVN LPSYYSSSSS SSSPMHGVAG DQGAQEEGWV  180
ICRVFKKKNL VHHGGGAAAA SHHAAAKLAA AAMEGSPSNC STVTVSDHVK AQMLHSSASD  240
DALDHILQYM GRSGCKQETK PAAMSASSAA AAAALEQHLS TPQYGKFMKL PPLEHVAGGV  300
GLLAAAGGGG EYCSAADASG IADWDTLDRL AASYELNGAL SDVASGKNMA GFFDVVDQPA  360
GAAAFSSGDG DLWSLARSVS SSLHADLTTM NNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-48818914167NAC domain-containing protein 19
4dul_A1e-48818914167NAC domain-containing protein 19
1ut7_B1e-48818914167NO APICAL MERISTEM PROTEIN
1ut7_A1e-48818914167NO APICAL MERISTEM PROTEIN
1ut4_B1e-48818914167NO APICAL MERISTEM PROTEIN
1ut4_A1e-48818914167NO APICAL MERISTEM PROTEIN
3swp_D1e-48818917170NAC domain-containing protein 19
3swp_C1e-48818917170NAC domain-containing protein 19
3swp_B1e-48818917170NAC domain-containing protein 19
3swp_A1e-48818917170NAC domain-containing protein 19
3swm_D1e-48818917170NAC domain-containing protein 19
3swm_C1e-48818917170NAC domain-containing protein 19
3swm_B1e-48818917170NAC domain-containing protein 19
3swm_A1e-48818917170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8331240.0CT833124.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA241M20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643041.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-108NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0E0A4J20.0A0A0E0A4J2_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g04090.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA022006-PA0.0(Oryza sativa Indica Group)
STRINGORGLA06G0019800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.12e-94NAC family protein